PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9374017g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 481aa    MW: 53872.8 Da    PI: 5.5842
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9374017g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
  MA_9374017g0010 14 KGPWTPEEDQILISYINKHGHGNWRALPKQAGLMRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.54.1e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++  E++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  MA_9374017g0010  67 RGNFSLKEEQTIIHLHQILGNR-WSAIASHLP-GRTDNEIKNVWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.309965IPR017930Myb domain
SuperFamilySSF466893.74E-3110108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002497.5E-171461IPR001005SANT/Myb domain
CDDcd001671.54E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129418.43866116IPR017930Myb domain
SMARTSM007178.9E-1466114IPR001005SANT/Myb domain
PfamPF002495.1E-1467112IPR001005SANT/Myb domain
CDDcd001675.98E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MGRAPRCDEM GLKKGPWTPE EDQILISYIN KHGHGNWRAL PKQAGLMRCG KSCRLRWTNY  60
LRPDIKRGNF SLKEEQTIIH LHQILGNRWS AIASHLPGRT DNEIKNVWNT HLKKRLLQIG  120
VDPVTHAPRG YNVSNCYAAV SIRDHHGEQA DHHLQSHGCT SESVKKVFRK EGNSIEPLAR  180
QPLQETKALQ DEGASNNSPL IQKTPDDQNM MNSEQHESYY SLNSSGNNYT YSSDSSRVLS  240
TKPMELVSAS AFGLCSGMDK EQNNSEKLTA GMPFDYSKTG EKKMLAVDYT SLLQSSYTDS  300
LKFILDDDGE DSNSSEYQVN WKPSAGNQQN FVSLGCGEFQ DDDKAVVQQA DPEGNLAYDS  360
SMLNSNVEFW RHELSLWPAT ENNTLGEQVL AYSSSNGAAA AVSGQQKKVK LEPSGTNFSV  420
EQFLELADHT MGTNMEGKSN IYDRWPDMNL ADQDQGMEYW VNLLRQVGPL PFLETISPPD  480
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0713060.0BT071306.1 Picea sitchensis clone WS02822_M18 unknown mRNA.
GenBankBT1175330.0BT117533.1 Picea glauca clone GQ03902_G23 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLC0PSI20.0C0PSI2_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.11e-75myb domain protein 107